SERMORELIN
GHRH(1–29) amide used as a short-acting somatotropic-axis reference.
Generic reference image · not a photograph of this compound
Research context
Sermorelin is the synthetic 29-residue N-terminal fragment of growth-hormone-releasing hormone, amidated at the C-terminus. It is the short-acting GHRH reference against which longer analogues are compared in GH-secretion assays.
Strengths & pricing
- 5 mg
- $1,950 MXN
Prices are listed in Mexican pesos (MXN) for each strength and are informational only. This site has no cart, checkout or payment step.
Specification
- Purity
- ≥98% (HPLC)
- Shelf life
- 24 months at −20 °C
- Molecular formula — reference
- C149H246N44O42S
- Molecular weight — reference
- 3357.9 g/mol
- CAS number — reference
- 86168-78-7
- Appearance — reference
- White lyophilized powder
- Solubility — reference
- Soluble in water
- Storage guidance
- −20 °C, protected from light
Rows marked “reference” are published literature values for the compound identity, not measurements made on a supplied lot. Certificates of analysis, identity data and safety sheets are not yet published for the compounds in this catalogue. Nothing on this site should be read as certification, purity verification or a testing claim.
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Handling
The C-terminal amide is part of the active sequence — confirm it by mass spectrometry before use.
More in GH Secretagogues
View group →CJC-1295 + Ipamorelin
Fixed-ratio blend pairing a GHRH analogue with a selective ghrelin-receptor agonist.
- 10 mg (5 mg + 5 mg)$2,100 MXN
- 20 mg (10 mg + 10 mg)$3,050 MXN
Prices in MXN
TESAMORELIN
Stabilised GHRH(1–44) analogue used in lipolytic and GH-axis models.
- 10 mg$2,350 MXN
- 25 mg$3,150 MXN
Prices in MXN
TESAMORELIN + IPAMORELIN
Co-lyophilised GHRH analogue and ghrelin-receptor agonist.
- 11 mg + 3 mg$2,950 MXN
Prices in MXN